Bacterial prsA protein

Produktübersicht

• Artikelname: Bacterial prsA protein
• Artikelnummer: BYT-ORB358820
• Hersteller Artikelnummer: orb358820
• Alternativnummer: BYT-ORB358820-1,BYT-ORB358820-100,BYT-ORB358820-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: prsA, SACOL1897, Foldase protein PrsA, EC 5.2.1.8

Produktbeschreibung

This Bacterial prsA protein spans the amino acid sequence from region 21-320aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 49.6 kDa
• UniProt: Q5HET4
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Staphylococcus aureus (strain COL)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: CGASATDSKENTLISSKAGDVTVADTMKKIGKDQIANASFTEMLNKILADKYKNKVNDKKIDEQIEKMQKQYGGKDKFEKALQQQGLTADKYKENLRTAAYHKELLSDKIKISDSEIKEDSKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKDPSKFGEIAKKESMDTGSAKKDGELGYVLKGQTDKDFEKALFKLKDGEVSEVVKSSFGYHIIKADKPTDFNSEKQSLKEKLVDQKVQKNPKLLTDA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Staphylococcus aureus (strain COL). Application Notes: This is His-SUMO-tag protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain COL) prsA.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureus (strain COL) prsA.