Human CD8A protein

Artikelnummer: BYT-ORB358935
Artikelname: Human CD8A protein
Artikelnummer: BYT-ORB358935
Hersteller Artikelnummer: orb358935
Alternativnummer: BYT-ORB358935-1,BYT-ORB358935-100,BYT-ORB358935-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: T-lymphocyte differentiation antigen T8/Leu-2 CD_antigen, CD8a
This Human CD8A protein spans the amino acid sequence from region 22-182aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 21.6 kDa
UniProt: P01732
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full length of HIS-tag and expression region is 21.81kDa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) CD8A.
Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) CD8A.