Human IL22 protein (Active)

Artikelnummer: BYT-ORB358985
Artikelname: Human IL22 protein (Active)
Artikelnummer: BYT-ORB358985
Hersteller Artikelnummer: orb358985
Alternativnummer: BYT-ORB358985-10,BYT-ORB358985-100,BYT-ORB358985-500
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: IL 22 protein,ILTIF protein,IL TIF protein,IL D110 protein,zcyto18 protein,MGC79382 protein,MGC79384 protein,TIFIL 23 protein,IL22 protein
This Human IL22 protein (Active) spans the amino acid sequence from region 34-179aa. Purity: > 97% as determined by SDS-PAGE and HPLC.
Molekulargewicht: 16.9 kDa
UniProt: Q9GZX6
Puffer: Lyophilized from a 0.2 µm filtered PBS, pH 5.0
Quelle: Homo sapiens (Human)
Reinheit: > 97% as determined by SDS-PAGE and HPLC.
Formulierung: Lyophilized powder
Sequenz: M+APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by inducing IL-10 secretion of human COLO 205 cells is less than 0.3 ng/ml, corresponding to a specific activity of > 3.3 x 10 6 IU/mg. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
orb358985
orb358985