Mouse IL5 protein (Active)

Produktübersicht

• Artikelname: Mouse IL5 protein (Active)
• Artikelnummer: BYT-ORB359011
• Hersteller Artikelnummer: orb359011
• Alternativnummer: BYT-ORB359011-100,BYT-ORB359011-5,BYT-ORB359011-500
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: IL-5, BCGF-II, Cytotoxic T-lymphocyte inducer, Eosinophil differentiation factor, T-cell replacing factor

Produktbeschreibung

This Mouse IL5 protein (Active) spans the amino acid sequence from region 21-133aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Produkteigenschaften

• Molekulargewicht: 13.1 kDa
• UniProt: P04401
• Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris, pH 9.0, 150 mM NaCl
• Quelle: Mus musculus (Mouse)
• Reinheit: > 98% as determined by SDS-PAGE and HPLC.
• Formulierung: Lyophilized powder
• Sequenz: MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 x 10 5 IU/mg. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

orb359011

orb359011