Bacterial entB protein

Artikelnummer: BYT-ORB382980
Artikelname: Bacterial entB protein
Artikelnummer: BYT-ORB382980
Hersteller Artikelnummer: orb382980
Alternativnummer: BYT-ORB382980-1,BYT-ORB382980-100,BYT-ORB382980-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: SEB
This Bacterial entB protein spans the amino acid sequence from region 28-266aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 55.4 kDa
UniProt: P01552
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Staphylococcus aureus
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK
Anwendungsbeschreibung: Biological Origin: Staphylococcus aureus. Application Notes: E.coli and Yeast N-terminal GST-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureusentB.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureusentB.