Dog Allergen Can f 2 protein

Artikelnummer: BYT-ORB383020
Artikelname: Dog Allergen Can f 2 protein
Artikelnummer: BYT-ORB383020
Hersteller Artikelnummer: orb383020
Alternativnummer: BYT-ORB383020-1,BYT-ORB383020-100,BYT-ORB383020-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Allergen Dog 2 Allergen, Can f 2
This Dog Allergen Can f 2 protein spans the amino acid sequence from region 19-180aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 34.4 kDa
UniProt: O18874
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Canis lupus familiaris (Dog) (Canis familiaris)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFIHSMSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSRD
Anwendungsbeschreibung: Biological Origin: Canis lupus familiaris (Dog) (Canis familiaris). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Canis familiaris (Dog) (Canis lupus familiaris) Minor allergen Can f 2.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Canis familiaris (Dog) (Canis lupus familiaris) Minor allergen Can f 2.