Viral kgp protein

Artikelnummer: BYT-ORB383026
Artikelname: Viral kgp protein
Artikelnummer: BYT-ORB383026
Hersteller Artikelnummer: orb383026
Alternativnummer: BYT-ORB383026-1,BYT-ORB383026-100,BYT-ORB383026-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Lysine-specific cysteine proteinase Kgp
This Viral kgp protein spans the amino acid sequence from region 229-594aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 56.6 kDa
UniProt: B2RLK2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DVYTDHGDLYNTPVRMLVVAGAKFKEALKPWLTWKAQKGFYLDVHYTDEAEVGTTNASIKAFIHKKYNDGLAASAAPVFLALVGDTDVISGEKGKKTKKVTDLYYSAVDGDYFPEMYTFRMSASSPEELTNIIDKVLMYEKATMPDKSYLEKALLIAGADSYWNPKIGQQTIKYAVQYYYNQDHGYTDVYSYPKAPYTGCYSHLNTGVGFANYTAHGSETSWADPSLTATQVKALTNKDKYFLAIGNCCVTAQFD
Anwendungsbeschreibung: Biological Origin: Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) kgp.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) kgp.