Bacterial lon protein

Produktübersicht

• Artikelname: Bacterial lon protein
• Artikelnummer: BYT-ORB383035
• Hersteller Artikelnummer: orb383035
• Alternativnummer: BYT-ORB383035-1,BYT-ORB383035-100,BYT-ORB383035-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: ATP-dependent protease La

Produktbeschreibung

This Bacterial lon protein spans the amino acid sequence from region 1-206aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 39.8 kDa
• UniProt: P78025
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mycoplasma pneumoniae (strain ATCC 29342 / M129)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MPAVKKPQILVVRNQVIFPYNGFELDVGRERSKKLIKALKNLKTKRLVLVTQKNSDQLNPEFDDIYHCGTLCDIDEIIEVPSEDGKTADYKIKGKGLQRVAITSFSDADLTKYDHHFLNSTLTENKALDKLLERIFPDKEDFAEILDSLNSFLELQELKKLSKVPKDIKRYDIITFKLASLIFKDITLQQAILEENDIEKRLQKII

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Mycoplasma pneumoniae (strain ATCC 29342 / M129). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycoplasma pneumoniae (strain ATCC 29342 / M129) lon.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycoplasma pneumoniae (strain ATCC 29342 / M129) lon.