Plant Gamma-glutamyl hydrolase protein

Produktübersicht

• Artikelname: Plant Gamma-glutamyl hydrolase protein
• Artikelnummer: BYT-ORB383051
• Hersteller Artikelnummer: orb383051
• Alternativnummer: BYT-ORB383051-1,BYT-ORB383051-100,BYT-ORB383051-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Conjugase GH Gamma-Glu-X carboxypeptidase

Produktbeschreibung

This Plant Gamma-glutamyl hydrolase protein spans the amino acid sequence from region 22-342aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 51.3 kDa
• UniProt: P93164
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Glycine max (Soybean) (Glycine hispida)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: ATSHDDHIFLPSQLHDDDSVSCTATDPSLNYKPVIGILTHPGDGASGRLSNATGVSYIAASYVKFVESGGARVIPLIYNESPENLNKKLDLVNGVLFTGGWAVSGPYLDTLGNIFKKALERNDAGDHFPVIAFNLGGNLVIRIVSEQTDILEPFTASSLPSSLVLWNEANAKGSLFQRFPSDLLTQLKTDCLVLHNHRYAISPRKLQYNTKLSDFFEILATSGDRDGKTFVSTARGRKYPVTVNLWQPEKNAFEW

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Glycine max (Soybean) (Glycine hispida). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Glycine max (Soybean) (Glycine hispida).

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Glycine max (Soybean) (Glycine hispida).