Plant Gamma-glutamyl hydrolase protein
Artikelnummer:
BYT-ORB383051
- Bilder (3)
| Artikelname: | Plant Gamma-glutamyl hydrolase protein |
| Artikelnummer: | BYT-ORB383051 |
| Hersteller Artikelnummer: | orb383051 |
| Alternativnummer: | BYT-ORB383051-1,BYT-ORB383051-100,BYT-ORB383051-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Conjugase GH Gamma-Glu-X carboxypeptidase |
| This Plant Gamma-glutamyl hydrolase protein spans the amino acid sequence from region 22-342aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 51.3 kDa |
| UniProt: | P93164 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Glycine max (Soybean) (Glycine hispida) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | ATSHDDHIFLPSQLHDDDSVSCTATDPSLNYKPVIGILTHPGDGASGRLSNATGVSYIAASYVKFVESGGARVIPLIYNESPENLNKKLDLVNGVLFTGGWAVSGPYLDTLGNIFKKALERNDAGDHFPVIAFNLGGNLVIRIVSEQTDILEPFTASSLPSSLVLWNEANAKGSLFQRFPSDLLTQLKTDCLVLHNHRYAISPRKLQYNTKLSDFFEILATSGDRDGKTFVSTARGRKYPVTVNLWQPEKNAFEW |
| Anwendungsbeschreibung: | Biological Origin: Glycine max (Soybean) (Glycine hispida). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length |



