Hamster PRDX1 protein

Produktübersicht

• Artikelname: Hamster PRDX1 protein
• Artikelnummer: BYT-ORB383082
• Hersteller Artikelnummer: orb383082
• Alternativnummer: BYT-ORB383082-1,BYT-ORB383082-100,BYT-ORB383082-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Thioredoxin peroxidase 2 Short name, TPX-2

Produktbeschreibung

This Hamster PRDX1 protein spans the amino acid sequence from region 2-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 26.1 kDa
• UniProt: Q9JKY1
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SSGNAKIGYPAPNFKATAVMPDGQFRDICLSEYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) PRDX1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) PRDX1.