Human AKAP4 protein

Produktübersicht

• Artikelname: Human AKAP4 protein
• Artikelnummer: BYT-ORB383159
• Hersteller Artikelnummer: orb383159
• Alternativnummer: BYT-ORB383159-1,BYT-ORB383159-100,BYT-ORB383159-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: A-kinase anchor protein 82KDA Short name, AKAP 82 Short name, hAKAP82 Major sperm fibrous sheath protein Short name, HI Protein kinase A-anchoring protein 4 Short name, PRKA4

Produktbeschreibung

This Human AKAP4 protein spans the amino acid sequence from region 189-854aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 77.3 kDa
• UniProt: Q5JQC9
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: QSPSAPPAKPPSTQRAVISPDGECSIDDLSFYVNRLSSLVIQMAHKEIKEKLEGKSKCLHHSICPSPGNKERISPRTPASKIASEMAYEAVELTAAEMRGTGEESREGGQKSFLYSELSNKSKSGDKQMSQRESKEFADSISKGLMVYANQVASDMMVSLMKTLKVHSSGKPIPASVVLKRVLLRHTKEIVSDLIDSCMKNLHNITGVLMTDSDFVSAVKRNLFNQWKQNATDIMEAMLKRLVSALIGEEKETKS

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

SDS-PAGE analysis of Human AKAP4 protein.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.