Human ICA1 protein

Produktübersicht

• Artikelname: Human ICA1 protein
• Artikelnummer: BYT-ORB383196
• Hersteller Artikelnummer: orb383196
• Alternativnummer: BYT-ORB383196-1,BYT-ORB383196-100,BYT-ORB383196-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: 69KDA islet cell autoantigen Short name, ICA69 Islet cell autoantigen p69 Short name, ICAp69 Short name, p69

Produktbeschreibung

This Human ICA1 protein spans the amino acid sequence from region 1-482aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 56.6 kDa
• UniProt: Q05084
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSGHKCYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESF

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The purity of ICA1 was greater than 90% as determined by SEC-HPLC