Human CHI3L1 protein

Produktübersicht

• Artikelname: Human CHI3L1 protein
• Artikelnummer: BYT-ORB383424
• Hersteller Artikelnummer: orb383424
• Alternativnummer: BYT-ORB383424-1,BYT-ORB383424-100,BYT-ORB383424-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: 39KDA synovial protein Cartilage glycoprotein 39

Produktbeschreibung

This Human CHI3L1 protein spans the amino acid sequence from region 22-383aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 60.5 kDa
• UniProt: P36222
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: YKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISNDHIDTWEWNDVTLYGMLNTLKNRNPNLKTLLSVGGWNFGSQRFSKIASNTQSRRTFIKSVPPFLRTHGFDGLDLAWLYPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHLDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRLGAPASKLVMGIPTFGRSFTLASSETGVGA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 10xHis-sumo-tagged and C-terminal Myc-tagged Full Length of Mature Protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CHI3L1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CHI3L1.