ORF2 protein

Artikelnummer: BYT-ORB383436
Artikelname: ORF2 protein
Artikelnummer: BYT-ORB383436
Hersteller Artikelnummer: orb383436
Alternativnummer: BYT-ORB383436-1,BYT-ORB383436-100,BYT-ORB383436-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: p59
This ORF2 protein spans the amino acid sequence from region 1-530aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 59.6 kDa
UniProt: Q83884
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Norovirus (strain Human/NoV/United States/Norwalk/1968/GI) (Hu/NV/NV/1968/US)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MMMASKDATSSVDGASGAGQLVPEVNASDPLAMDPVAGSSTAVATAGQVNPIDPWIINNFVQAPQGEFTISPNNTPGDVLFDLSLGPHLNPFLLHLSQMYNGWVGNMRVRIMLAGNAFTAGKIIVSCIPPGFGSHNLTIAQATLFPHVIADVRTLDPIEVPLEDVRNVLFHNNDRNQQTMRLVCMLYTPLRTGGGTGDSFVVAGRVMTCPSPDFNFLFLVPPTVEQKTRPFTLPNLPLSSLSNSRAPLPISSMGI
Anwendungsbeschreibung: Biological Origin: Norovirus (strain Human/NoV/United States/Norwalk/1968/GI) (Hu/NV/NV/1968/US). Application Notes: Baculovirus and Mammalian Cell C-terminal Flag-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.