Human ATP5A1 protein

Produktübersicht

• Artikelname: Human ATP5A1 protein
• Artikelnummer: BYT-ORB418703
• Hersteller Artikelnummer: orb418703
• Alternativnummer: BYT-ORB418703-20,BYT-ORB418703-100,BYT-ORB418703-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: ATP synthase alpha chain, ATP synthase alpha chain, mitochondrial, ATP synthase subunit alpha, ATP synthase subunit alpha mitochondrial, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, 1, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform 1, cardiac muscle, ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform 2, non-cardiac muscle-like 2, ATP sythase (F1 ATPase) alpha subunit, ATP5A, Atp5a1, ATP5AL2, ATPA_HUMAN, ATPM, Epididymis secretory sperm binding protein Li 123m, hATP1, HEL-S-123m, MC5DN4, mitochondrial, Mitochondrial ATP synthetase, Mitochondrial ATP synthetase oligomycin resistant, Modifier of Min 2, Modifier of Min 2 mouse homolog, Modifier of Min 2, mouse, homolog of, MOM2, OMR, ORM, OTTHUMP00000163475

Produktbeschreibung

This Human ATP5A1 protein spans the amino acid sequence from region 44-553aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 71.2 kDa
• UniProt: P25705
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: QKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGE

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 44-553aaSequence Info: Full Length of Mature Protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ATP5A1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ATP5A1.