Human ATP5D protein

Artikelnummer: BYT-ORB418704
Artikelname: Human ATP5D protein
Artikelnummer: BYT-ORB418704
Hersteller Artikelnummer: orb418704
Alternativnummer: BYT-ORB418704-20,BYT-ORB418704-100,BYT-ORB418704-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: F-ATPase delta subunit
This Human ATP5D protein spans the amino acid sequence from region 23-168aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 31 kDa
UniProt: P30049
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 23-168aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ATP5D.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) ATP5D.