Human ATP6AP2 protein

Artikelnummer: BYT-ORB418705
Artikelname: Human ATP6AP2 protein
Artikelnummer: BYT-ORB418705
Hersteller Artikelnummer: orb418705
Alternativnummer: BYT-ORB418705-20,BYT-ORB418705-100,BYT-ORB418705-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: ATP6M8-9 , V-ATPase M8.9 subunit
This Human ATP6AP2 protein spans the amino acid sequence from region 17-350aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 53.5 kDa
UniProt: O75787
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDT
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 17-350aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.