Human BRCC3 protein

Produktübersicht

• Artikelname: Human BRCC3 protein
• Artikelnummer: BYT-ORB418706
• Hersteller Artikelnummer: orb418706
• Alternativnummer: BYT-ORB418706-20,BYT-ORB418706-100,BYT-ORB418706-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: BR, CA1-A complex subunit BR, CC36BR, CA1/BR, CA2-containing complex subunit 3BR, CA1/BR, CA2-containing complex subunit 36BRISC complex subunit BR, CC36

Produktbeschreibung

This Human BRCC3 protein spans the amino acid sequence from region 2-316aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 65.9 kDa
• UniProt: P46736
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: AVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-GST-tagged Expression Region: 2-316aaSequence Info: Full Length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.