Primate CCL20 protein

Artikelnummer: BYT-ORB418709
Artikelname: Primate CCL20 protein
Artikelnummer: BYT-ORB418709
Hersteller Artikelnummer: orb418709
Alternativnummer: BYT-ORB418709-20,BYT-ORB418709-100,BYT-ORB418709-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: /
This Primate CCL20 protein spans the amino acid sequence from region 27-96aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 35.1 kDa
UniProt: Q8HYP6
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Macaca mulatta (Rhesus macaque)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ASNFDCCLRYTDRILHPKFIVGFTQQLANETCDINAVVFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM
Anwendungsbeschreibung: Biological Origin: Macaca mulatta (Rhesus macaque). Application Notes: Tag Info: N-terminal GST-taggedExpression Region: 27-96aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.