Mouse CHRNA1 protein

Artikelnummer: BYT-ORB418712
Artikelname: Mouse CHRNA1 protein
Artikelnummer: BYT-ORB418712
Hersteller Artikelnummer: orb418712
Alternativnummer: BYT-ORB418712-20,BYT-ORB418712-100,BYT-ORB418712-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Chrna1, Acra, Acetylcholine receptor subunit alpha
This Mouse CHRNA1 protein spans the amino acid sequence from region 21-230aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 28.5 kDa
UniProt: P04756
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 21-230aaSequence Info: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.