Fish CHRNA1 protein

Produktübersicht

• Artikelname: Fish CHRNA1 protein
• Artikelnummer: BYT-ORB418714
• Hersteller Artikelnummer: orb418714
• Alternativnummer: BYT-ORB418714-20,BYT-ORB418714-100,BYT-ORB418714-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: CHRNA1Acetylcholine receptor subunit alpha

Produktbeschreibung

This Fish CHRNA1 protein spans the amino acid sequence from region 25-234aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 40.8 kDa
• UniProt: P02710
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Tetronarce californica (Pacific electric ray) (Torpedo californica)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Tetronarce californica (Pacific electric ray) (Torpedo californica). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 25-234aaSequence Info: Extracellular Domain

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Tetronarce californica (Pacific electric ray) (Torpedo californica) CHRNA1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Tetronarce californica (Pacific electric ray) (Torpedo californica) CHRNA1.