Mouse S100A8 protein

Artikelnummer: BYT-ORB418741
Artikelname: Mouse S100A8 protein
Artikelnummer: BYT-ORB418741
Hersteller Artikelnummer: orb418741
Alternativnummer: BYT-ORB418741-20,BYT-ORB418741-100,BYT-ORB418741-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Calgranulin-AChemotactic cytokine CP-10Leukocyte L1 complex light chain, Migration inhibitory factor-related protein 8 , MRP-8 , p8Pro-inflammatory S100 cytokine, S100 calcium-binding protein A8
This Mouse S100A8 protein spans the amino acid sequence from region 2-89aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 26.2 kDa
UniProt: P27005
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 2-89aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) S100a8.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) S100a8.