Bacterial TETX protein

Produktübersicht

• Artikelname: Bacterial TETX protein
• Artikelnummer: BYT-ORB418757
• Hersteller Artikelnummer: orb418757
• Alternativnummer: BYT-ORB418757-20,BYT-ORB418757-100,BYT-ORB418757-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Tentoxylysin

Produktbeschreibung

This Bacterial TETX protein spans the amino acid sequence from region 123-573aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 55.4 kDa
• UniProt: P04958
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Clostridium tetani (strain Massachusetts / E88)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: SLLDKFDTNSNSVSFNLLEQDPSGATTKSAMLTNLIIFGPGPVLNKNEVRGIVLRVDNKNYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVLHGLYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYKAIANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTEIELGKKFNIKTRLSYFS

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Clostridium tetani (strain Massachusetts / E88). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 123-573aaSequence Info: Partial

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Clostridium tetani (strain Massachusetts / E88) tetX.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Clostridium tetani (strain Massachusetts / E88) tetX.