E. coli ISPU protein

Produktübersicht

• Artikelname: E. coli ISPU protein
• Artikelnummer: BYT-ORB418824
• Hersteller Artikelnummer: orb418824
• Alternativnummer: BYT-ORB418824-20,BYT-ORB418824-100,BYT-ORB418824-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Ditrans,polycis-undecaprenylcistransferase Undecaprenyl diphosphate synthase Short name, UDS Undecaprenyl pyrophosphate synthase Short name, UPP synthase

Produktbeschreibung

This E. coli ISPU protein spans the amino acid sequence from region 1-253aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 32.4 kDa
• UniProt: P60472
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Escherichia coli (strain K12)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MMLSATQPLSEKLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLAEKVQQGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRFGGTEPGDETA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Escherichia coli (strain K12). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 1-253aaSequence Info: Partial

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.