Human RBM14 protein

Produktübersicht

• Artikelname: Human RBM14 protein
• Artikelnummer: BYT-ORB418825
• Hersteller Artikelnummer: orb418825
• Alternativnummer: BYT-ORB418825-20,BYT-ORB418825-100,BYT-ORB418825-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Paraspeckle protein 2 Short name, PSP2 RNA-binding motif protein 14 RRM-containing coactivator activator/modulator Synaptotagmin-interacting protein Short name, SYT-interacting protein

Produktbeschreibung

This Human RBM14 protein spans the amino acid sequence from region 1-669aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 85.5 kDa
• UniProt: Q96PK6
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQPATYRAQPSVSLGAAYRAQPSA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-669aaSequence Info: Full Length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.