Plant Pectate lyase 1 protein

Artikelnummer: BYT-ORB418831
Artikelname: Plant Pectate lyase 1 protein
Artikelnummer: BYT-ORB418831
Hersteller Artikelnummer: orb418831
Alternativnummer: BYT-ORB418831-20,BYT-ORB418831-100,BYT-ORB418831-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Major pollen allergen Cup a 1 Allergen, Cup a 1
This Plant Pectate lyase 1 protein spans the amino acid sequence from region 22-367aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 65.1 kDa
UniProt: Q9SCG9
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Hesperocyparis arizonica (Arizona cypress) (Cupressus arizonica)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRKASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGG
Anwendungsbeschreibung: Biological Origin: Hesperocyparis arizonica (Arizona cypress) (Cupressus arizonica). Application Notes: Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-taggedExpression Region: 22-367aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.