Human CEACAM1 protein

Produktübersicht

• Artikelname: Human CEACAM1 protein
• Artikelnummer: BYT-ORB418832
• Hersteller Artikelnummer: orb418832
• Alternativnummer: BYT-ORB418832-20,BYT-ORB418832-100,BYT-ORB418832-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Biliary glycoprotein 1 Short name, BGP-1

Produktbeschreibung

This Human CEACAM1 protein spans the amino acid sequence from region 35-428aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 63.3 kDa
• UniProt: P13688
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: QLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTPTISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQSTQELFIPNI

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 35-428aaSequence Info: Full Length of Mature Protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.