Pig GPX5 protein

Produktübersicht

• Artikelname: Pig GPX5 protein
• Artikelnummer: BYT-ORB418840
• Hersteller Artikelnummer: orb418840
• Alternativnummer: BYT-ORB418840-20,BYT-ORB418840-100,BYT-ORB418840-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Epididymis-specific glutathione peroxidase-like protein Short name, EGLP Glutathione peroxidase 5 Short name, GPx-5 Short name, GSHPx-

Produktbeschreibung

This Pig GPX5 protein spans the amino acid sequence from region 22-219aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 42.6 kDa
• UniProt: O18994
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Sus scrofa (Pig)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Sus scrofa (Pig). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 22-219aaSequence Info: Full Length of Mature Protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.