Plant Cyanovirin-N homolog protein

Artikelnummer: BYT-ORB418842
Artikelname: Plant Cyanovirin-N homolog protein
Artikelnummer: BYT-ORB418842
Hersteller Artikelnummer: orb418842
Alternativnummer: BYT-ORB418842-20,BYT-ORB418842-100,BYT-ORB418842-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Cyanovirin-N homolog, CV-N homolog
This Plant Cyanovirin-N homolog protein spans the amino acid sequence from region 28-142aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 14.9 kDa
UniProt: P86326
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Ceratopteris richardii (Triangle waterfern)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYYIGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADGQYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE
Anwendungsbeschreibung: Biological Origin: Ceratopteris richardii (Triangle waterfern). Application Notes: Tag Info: N-terminal 10xHis-taggedExpression Region: 28-142aaSequence Info: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.