Bacterial P46 protein

Produktübersicht

• Artikelname: Bacterial P46 protein
• Artikelnummer: BYT-ORB418843
• Hersteller Artikelnummer: orb418843
• Alternativnummer: BYT-ORB418843-20,BYT-ORB418843-100,BYT-ORB418843-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: p46

Produktbeschreibung

This Bacterial P46 protein spans the amino acid sequence from region 28-416aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 46.5 kDa
• UniProt: P0C0J7
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mesomycoplasma hyopneumoniae (strain 232)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: CGQTESGSTSDSKPQAETLKHKVSNDSIRIALTDPDNPRWISAQKDIISYVDETEAATSTITKNQDAQNNWLTQQANLSPAPKGFIIAPENGSGVGTAVNTIADKGIPIVAYDRLITGSDKYDWYVSFDNEKVGELQGLSLAAGLLGKEDGAFDSIDQMNEYLKSHMPQETISFYTIAGSQDDNNSQYFYNGAMKVLKELMKNSQNKIIDLSPEGENAVYVPGWNYGTAGQRIQSFLTINKDPAGGNKIKAVGSK

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Mesomycoplasma hyopneumoniae (strain 232). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 28-416aaSequence Info: Full Length of Mature Protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycoplasma hyopneumoniae (strain 232) p46.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycoplasma hyopneumoniae (strain 232) p46.