Human UL111A protein

Produktübersicht

• Artikelname: Human UL111A protein
• Artikelnummer: BYT-ORB418862
• Hersteller Artikelnummer: orb418862
• Alternativnummer: BYT-ORB418862-20,BYT-ORB418862-100,BYT-ORB418862-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: UL111A, Viral interleukin-10 homolog, cmvIL-10, vIL-10

Produktbeschreibung

This Human UL111A protein spans the amino acid sequence from region 26-176aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 17.5 kDa
• UniProt: F5HC71
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: ATTTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5). Application Notes: Tag Info: NO-taggedExpression Region: 26-176aaSequence Info: Full Length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5) UL111A.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5) UL111A.