Rat FXN protein

Artikelnummer: BYT-ORB418879
Artikelname: Rat FXN protein
Artikelnummer: BYT-ORB418879
Hersteller Artikelnummer: orb418879
Alternativnummer: BYT-ORB418879-20,BYT-ORB418879-100,BYT-ORB418879-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: FxnFrataxin, mitochondrial, Fxn, EC 1.16.3.1) [Cleaved into, Frataxin intermediate form, Frataxin mature form]
This Rat FXN protein spans the amino acid sequence from region 41-208aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 18.6 kDa
UniProt: D3ZYW7
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Rattus norvegicus (Rat)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT
Anwendungsbeschreibung: Biological Origin: Rattus norvegicus (Rat). Application Notes: Tag Info: NO-taggedExpression Region: 41-208aaSequence Info: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.