E. coli FANC protein

Artikelnummer: BYT-ORB418885
Artikelname: E. coli FANC protein
Artikelnummer: BYT-ORB418885
Hersteller Artikelnummer: orb418885
Alternativnummer: BYT-ORB418885-20,BYT-ORB418885-100,BYT-ORB418885-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: fanCK99 fimbrial protein
This E. coli FANC protein spans the amino acid sequence from region 23-181aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 32.5 kDa
UniProt: P18103
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM
Anwendungsbeschreibung: Biological Origin: Escherichia coli. Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 23-181aaSequence Info: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.