Mouse ADH2 protein

Artikelnummer: BYT-ORB418894
Artikelname: Mouse ADH2 protein
Artikelnummer: BYT-ORB418894
Hersteller Artikelnummer: orb418894
Alternativnummer: BYT-ORB418894-1,BYT-ORB418894-100,BYT-ORB418894-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Alcohol dehydrogenase class-III Glutathione-dependent formaldehyde dehydrogenase
This Mouse ADH2 protein spans the amino acid sequence from region 2-379aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 44.7 kDa
UniProt: Q96533
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Arabidopsis thaliana (Mouse-ear cress)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ATQGQVITCKAAVAYEPNKPLVIEDVQVAPPQAGEVRIKILYTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVTEVQAGDHVIPCYQAECRECKFCKSGKTNLCGKVRSATGVGIMMNDRKSRFSVNGKPIYHFMGTSTFSQYTVVHDVSVAKIDPTAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSNVAIFGLGTVGLAVAEGAKTAGASRIIGIDIDSKKYETAKKFGVNEFVNPKDHDKPIQEV
Anwendungsbeschreibung: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 2-379aaSequence Info: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.