Human Smad2 protein

Artikelnummer: BYT-ORB418899
Artikelname: Human Smad2 protein
Artikelnummer: BYT-ORB418899
Hersteller Artikelnummer: orb418899
Alternativnummer: BYT-ORB418899-1,BYT-ORB418899-100,BYT-ORB418899-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: JV18-1 Mad-related protein 2
This Human Smad2 protein spans the amino acid sequence from region 2-467aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 68.2 kDa
UniProt: Q15796
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSP
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 2-467aaSequence Info: Full Length of BC000506
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.