Mouse KLK14 protein

Artikelnummer: BYT-ORB418900
Artikelname: Mouse KLK14 protein
Artikelnummer: BYT-ORB418900
Hersteller Artikelnummer: orb418900
Alternativnummer: BYT-ORB418900-1,BYT-ORB418900-100,BYT-ORB418900-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Glandular kallikrein KLK14
This Mouse KLK14 protein spans the amino acid sequence from region 24-250aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 28.5 kDa
UniProt: Q8CGR5
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: IIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAAHCARPILHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKVRLGRAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQACHRAYPGIITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWIQRTMQSN
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 24-250aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.