Human IGF-1 protein

Artikelnummer: BYT-ORB418908
Artikelname: Human IGF-1 protein
Artikelnummer: BYT-ORB418908
Hersteller Artikelnummer: orb418908
Alternativnummer: BYT-ORB418908-1,BYT-ORB418908-100,BYT-ORB418908-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Mechano growth factor
This Human IGF-1 protein spans the amino acid sequence from region 49-118aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 9.7 kDa
UniProt: P05019
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 49-118aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.