Human PIP protein

Artikelnummer: BYT-ORB418911
Artikelname: Human PIP protein
Artikelnummer: BYT-ORB418911
Hersteller Artikelnummer: orb418911
Alternativnummer: BYT-ORB418911-20,BYT-ORB418911-100,BYT-ORB418911-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Gross cystic disease fluid protein 15
This Human PIP protein spans the amino acid sequence from region 29-146aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 16 kDa
UniProt: P12273
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 10xHis-taggedExpression Region: 29-146aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PIP.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PIP.