Bacterial HRP1 protein

Produktübersicht

• Artikelname: Bacterial HRP1 protein
• Artikelnummer: BYT-ORB418912
• Hersteller Artikelnummer: orb418912
• Alternativnummer: BYT-ORB418912-20,BYT-ORB418912-100,BYT-ORB418912-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: hrp1, Rv2626cHypoxic response protein 1, HRP1

Produktbeschreibung

This Bacterial HRP1 protein spans the amino acid sequence from region 1-143aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 35.5 kDa
• UniProt: P9WJA3
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-143aaSequence Info: Full Length of Mature Protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) hrp1.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) hrp1.