Rat NOX4 protein

Artikelnummer: BYT-ORB418913
Artikelname: Rat NOX4 protein
Artikelnummer: BYT-ORB418913
Hersteller Artikelnummer: orb418913
Alternativnummer: BYT-ORB418913-1,BYT-ORB418913-100,BYT-ORB418913-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Kidney oxidase-1
This Rat NOX4 protein spans the amino acid sequence from region 210-424aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 38.6 kDa
UniProt: Q924V1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Rattus norvegicus (Rat)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVSEHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE
Anwendungsbeschreibung: Biological Origin: Rattus norvegicus (Rat). Application Notes: Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 210-424aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.