Mouse CTDP1 protein

Artikelnummer: BYT-ORB418919
Artikelname: Mouse CTDP1 protein
Artikelnummer: BYT-ORB418919
Hersteller Artikelnummer: orb418919
Alternativnummer: BYT-ORB418919-1,BYT-ORB418919-100,BYT-ORB418919-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: TFIIF-associating CTD phosphatase
This Mouse CTDP1 protein spans the amino acid sequence from region 178-341aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 24 kDa
UniProt: Q7TSG2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: HRNRKLVLMVDLDQTLIHTTEQHCPQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFPGTGDVNAPPAARETQAR
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 178-341aaSequence Info: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.