Rat TPSAB1 protein

Artikelnummer: BYT-ORB418934
Artikelname: Rat TPSAB1 protein
Artikelnummer: BYT-ORB418934
Hersteller Artikelnummer: orb418934
Alternativnummer: BYT-ORB418934-1,BYT-ORB418934-100,BYT-ORB418934-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Mast cell protease 7
This Rat TPSAB1 protein spans the amino acid sequence from region 29-273aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 47.4 kDa
UniProt: P27435
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Rattus norvegicus (Rat)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: IVGGQEASGNKWPWQVSLRVNDTYWMHFCGGSLIHPQWVLTAAHCVGPNKADPNKLRVQLRKQYLYYHDHLLTVSQIISHPDFYIAQDGADIALLKLTNPVNITSNVHTVSLPPASETFPSGTLCWVTGWGNINNDVSLPPPFPLEEVQVPIVENRLCDLKYHKGLNTGDNVHIVRDDMLCAGNEGHDSCQGDSGGPLVCKVEDTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIYRYVPKYF
Anwendungsbeschreibung: Biological Origin: Rattus norvegicus (Rat). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 29-273aaSequence Info: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.