Bacterial FBPB protein

Produktübersicht

• Artikelname: Bacterial FBPB protein
• Artikelnummer: BYT-ORB418943
• Hersteller Artikelnummer: orb418943
• Alternativnummer: BYT-ORB418943-20,BYT-ORB418943-100,BYT-ORB418943-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: 30KDA extracellular protein Acyl-CoA, diacylglycerol acyltransferase Antigen 85 complex B

Produktbeschreibung

This Bacterial FBPB protein spans the amino acid sequence from region 41-325aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 50.6 kDa
• UniProt: P21160
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mycobacterium kansasii
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: FSRPGLPVEYLQVPSAAMGRSIKVQFQSGGDNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSVIMPVGGQSSFYSDWYSPACGKAGCTTYKWETFLTSELPQWLSANRSVKPTGSAAVGISMAGSSALILSVYHPQQFIYAGSLSALMDPSQGMGPSLIGLAMGDAGGYKASDMWGPSSDPAWQRNDPSLHIPELVANNTRLWIYCGNGTPSELGGANVPAEFLENFVRSSNLKFQDAYNAAGGHNAVFN

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Mycobacterium kansasii. Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 41-325aaSequence Info: Full Length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium kansasiifbpB.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mycobacterium kansasiifbpB.