Mouse MGLL protein

Produktübersicht

• Artikelname: Mouse MGLL protein
• Artikelnummer: BYT-ORB418944
• Hersteller Artikelnummer: orb418944
• Alternativnummer: BYT-ORB418944-20,BYT-ORB418944-100,BYT-ORB418944-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Monoacylglycerol lipase

Produktbeschreibung

This Mouse MGLL protein spans the amino acid sequence from region 1-303aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 49.4 kDa
• UniProt: O35678
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Mus musculus (Mouse)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSR

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-303aaSequence Info: Full Length of Mature Protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Mgll.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Mgll.