Human SPRR2B protein

Artikelnummer: BYT-ORB418951
Artikelname: Human SPRR2B protein
Artikelnummer: BYT-ORB418951
Hersteller Artikelnummer: orb418951
Alternativnummer: BYT-ORB418951-1,BYT-ORB418951-100,BYT-ORB418951-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: SPRR2B, Small proline-rich protein 2B, SPR-2B
This Human SPRR2B protein spans the amino acid sequence from region 1-72aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 11.5 kDa
UniProt: P35325
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-taggedExpression Region: 1-72aaSequence Info: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.