Mouse CTLA4 protein
Artikelnummer:
BYT-ORB418953
- Bilder (3)
| Artikelname: | Mouse CTLA4 protein |
| Artikelnummer: | BYT-ORB418953 |
| Hersteller Artikelnummer: | orb418953 |
| Alternativnummer: | BYT-ORB418953-20,BYT-ORB418953-100,BYT-ORB418953-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Cytotoxic T-lymphocyte-associated antigen 4 |
| This Mouse CTLA4 protein spans the amino acid sequence from region 36-161aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 33.9 kDa |
| UniProt: | P09793 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Mus musculus (Mouse) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD |
| Anwendungsbeschreibung: | Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 36-161aaSequence Info: Partial |



