Animal Tick anticoagulant peptide protein

Produktübersicht

• Artikelname: Animal Tick anticoagulant peptide protein
• Artikelnummer: BYT-ORB418978
• Hersteller Artikelnummer: orb418978
• Alternativnummer: BYT-ORB418978-20,BYT-ORB418978-100,BYT-ORB418978-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Tick anticoagulant peptide, TAP

Produktbeschreibung

This Animal Tick anticoagulant peptide protein spans the amino acid sequence from region 1-60aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 9 kDa
• UniProt: P17726
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Ornithodoros moubata (Soft tick) (Argasid tick)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: YNRLCIKPRDWIDECDSNEGGERAYFRNGKGGCDSFWICPEDHTGADYYSSYRDCFNACI

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Ornithodoros moubata (Soft tick) (Argasid tick). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 1-60aaSequence Info: Full Length

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Ornithodoros moubata (Soft tick) (Argasid tick) Tick anticoagulant peptide.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Ornithodoros moubata (Soft tick) (Argasid tick) Tick anticoagulant peptide.