Animal Scytovirin protein

Produktübersicht

• Artikelname: Animal Scytovirin protein
• Artikelnummer: BYT-ORB418988
• Hersteller Artikelnummer: orb418988
• Alternativnummer: BYT-ORB418988-20,BYT-ORB418988-100,BYT-ORB418988-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Scytovirin, SVN

Produktbeschreibung

This Animal Scytovirin protein spans the amino acid sequence from region 1-95aa. Purity: Greater than 90% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 23.7 kDa
• UniProt: P86041
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Schistosoma mansoni (Blood fluke)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GSGPTYCWNEANNPGGPNRCSNNKQCDGARTCSSSGFCQGTSRKPDPGPKGPTYCWDEAKNPGGPNRCSNSKQCDGARTCSSSGFCQGTAGHAAA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Schistosoma mansoni (Blood fluke). Application Notes: Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 1-95aaSequence Info: Partial

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Schistosoma mansoni (Blood fluke).

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Schistosoma mansoni (Blood fluke).