Rat CRYGB protein

Produktübersicht

• Artikelname: Rat CRYGB protein
• Artikelnummer: BYT-ORB418992
• Hersteller Artikelnummer: orb418992
• Alternativnummer: BYT-ORB418992-20,BYT-ORB418992-100,BYT-ORB418992-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Gamma-B-crystallin Gamma-crystallin 1-2

Produktbeschreibung

This Rat CRYGB protein spans the amino acid sequence from region 2-175aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 23 kDa
• UniProt: P10066
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Rattus norvegicus (Rat)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: GKITFFEDRGFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWMLYERPNYQGHQYFLRRGDYPDYQQWMGFSDSIRSCRLIPQHSGTYRMRIYERDDFRGQMSEITDDCLSLQDRFHLSEIHSLNVMEGCWVLYEMPSYRGRQYLLRPGEYRRYLDWGAANAKVGSFRRVMDFY

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Rattus norvegicus (Rat). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 2-175aaSequence Info: Full Length of Mature Protein

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Rattus norvegicus (Rat) Crygb.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Rattus norvegicus (Rat) Crygb.