Human SH3YL1 protein

Produktübersicht

• Artikelname: Human SH3YL1 protein
• Artikelnummer: BYT-ORB419010
• Hersteller Artikelnummer: orb419010
• Alternativnummer: BYT-ORB419010-1,BYT-ORB419010-100,BYT-ORB419010-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: DKFZP586F1318, RAY, SH3 domain containing, Ysc84-like 1 (S. cerevisiae), SH3 domain-containing YSC84-like protein 1, SH3Y1_HUMAN, Sh3yl1

Produktbeschreibung

This Human SH3YL1 protein spans the amino acid sequence from region 1-342aa. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 40.6 kDa
• UniProt: Q96HL8
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAKGLAILSVIKAGFLVTARGGSGIVVARLPDGKWSAPSAIGIAGLGGGFEIGIEVSDLVIILNYDRAVEAFAKGGNLTLGGNLTVAVGPLGRNLEGNVALRSSAAVFTYCKSRGLFAGVSLEGSCLIERKETNRKFYCQDIRAYDILFGDTPRPAQAEDLYEILDSFTEKYENEGQRINARKAAREQRKSSAKELPPKPLSRPQQSSAPVQL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-taggedExpression Region: 1-342aaSequence Info: Partial

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) SH3YL1.

Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) SH3YL1.